KAT2B/PCAF Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: KAT2B/PCAF Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0066
• Hersteller Artikelnummer: A0066
• Alternativnummer: ABB-A0066-100UL,ABB-A0066-20UL,ABB-A0066-1000UL,ABB-A0066-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CAF, PCAF, P/CAF, KAT2B/PCAF

Produktbeschreibung

CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 93kDa
• NCBI: 8850
• UniProt: Q92831
• Reinheit: Affinity purification
• Sequenz: MSEAGGAGPGGCGAGAGAGAGPGALPPQPAALPPAPPQGSPCAAAAGGSGACGPATAVAAAGTAEGPGGGGSARIAVKKAQLRSAP
• Target-Kategorie: KAT2B
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Nuclear Receptor Signaling,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Cell cycle inhibitors,Cell Cycle Control-G2 M DNA Damage Checkpoint,Immunology Inflammation,NF-kB Signaling Pathway

Bilder