KAT2B/PCAF Rabbit pAb, Unconjugated

Catalog Number: ABB-A0066
Article Name: KAT2B/PCAF Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0066
Supplier Catalog Number: A0066
Alternative Catalog Number: ABB-A0066-100UL,ABB-A0066-20UL,ABB-A0066-1000UL,ABB-A0066-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CAF, PCAF, P/CAF, KAT2B/PCAF
CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation.
Clonality: Polyclonal
Molecular Weight: 93kDa
NCBI: 8850
UniProt: Q92831
Purity: Affinity purification
Sequence: MSEAGGAGPGGCGAGAGAGAGPGALPPQPAALPPAPPQGSPCAAAAGGSGACGPATAVAAAGTAEGPGGGGSARIAVKKAQLRSAP
Target: KAT2B
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Nuclear Receptor Signaling,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Cell cycle inhibitors,Cell Cycle Control-G2 M DNA Damage Checkpoint,Immunology Inflammation,NF-kB Signaling Pathway