KIFC1 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A0077
Artikelname: KIFC1 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A0077
Hersteller Artikelnummer: A0077
Alternativnummer: ABB-A0077-100UL,ABB-A0077-20UL,ABB-A0077-1000UL,ABB-A0077-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HSET, KNSL2, KIFC1
Predicted to enable microtubule binding activity and minus-end-directed microtubule motor activity. Involved in mitotic metaphase plate congression and mitotic spindle assembly. Located in membrane.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1808]
Molekulargewicht: 74kDa
NCBI: 3833
UniProt: Q9BW19
Reinheit: Affinity purification
Sequenz: MDPQRSPLLEVKGNIELKRPLIKAPSQLPLSGSRLKRRPDQMEDGLEPEKKRTRGLGATTKITTSHPRVPSLTTVPQTQGQTTAQKVSKKTGPRCSTAIA
Target-Kategorie: KIFC1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Cytoskeleton,Motor Proteins.