KIFC1 Rabbit mAb, Unconjugated

Product Overview

• Article Name: KIFC1 Rabbit mAb, Unconjugated
• Biozol Catalog Number: ABB-A0077
• Supplier Catalog Number: A0077
• Alternative Catalog Number: ABB-A0077-100UL,ABB-A0077-20UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: HSET, KNSL2, KIFC1

Product Description

Predicted to enable microtubule binding activity and minus-end-directed microtubule motor activity. Involved in mitotic metaphase plate congression and mitotic spindle assembly. Located in membrane.

Product Properties

• Clonality: Monoclonal
• Clone Designation: [ARC1808]
• Molecular Weight: 74kDa
• NCBI: 3833
• UniProt: Q9BW19
• Purity: Affinity purification
• Sequence: MDPQRSPLLEVKGNIELKRPLIKAPSQLPLSGSRLKRRPDQMEDGLEPEKKRTRGLGATTKITTSHPRVPSLTTVPQTQGQTTAQKVSKKTGPRCSTAIA
• Target: KIFC1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Cytoskeleton,Motor Proteins

Images