FGF1 Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A0079
- Bilder (2)
| Artikelname: | FGF1 Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A0079 |
| Hersteller Artikelnummer: | A0079 |
| Alternativnummer: | ABB-A0079-20UL,ABB-A0079-100UL,ABB-A0079-500UL,ABB-A0079-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AFGF, ECGF, FGFA, ECGFA, ECGFB, FGF-1, HBGF1, HBGF-1, GLIO703, ECGF-beta, FGF-alpha, FGF1 |
| The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 17kDa |
| NCBI: | 2246 |
| UniProt: | P05230 |
| Reinheit: | Affinity purification |
| Sequenz: | AEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
| Target-Kategorie: | FGF1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors,Cardiovascular,Angiogenesis. |


