FGF1 Rabbit pAb, Unconjugated

Catalog Number: ABB-A0079
Article Name: FGF1 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0079
Supplier Catalog Number: A0079
Alternative Catalog Number: ABB-A0079-20UL,ABB-A0079-100UL,ABB-A0079-500UL,ABB-A0079-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: AFGF, ECGF, FGFA, ECGFA, ECGFB, FGF-1, HBGF1, HBGF-1, GLIO703, ECGF-beta, FGF-alpha, FGF1
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described.
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 2246
UniProt: P05230
Purity: Affinity purification
Sequence: AEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Target: FGF1
Antibody Type: Primary Antibody
Application Dilute: IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors,Cardiovascular,Angiogenesis.
Immunofluorescence analysi