[KO Validated] CDK2 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: [KO Validated] CDK2 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0094
• Hersteller Artikelnummer: A0094
• Alternativnummer: ABB-A0094-100UL,ABB-A0094-20UL,ABB-A0094-500UL,ABB-A0094-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CDKN2, p33(CDK2), K2

Produktbeschreibung

This gene encodes a member of a family of serine/threonine protein kinases that participate in cell cycle regulation. The encoded protein is the catalytic subunit of the cyclin-dependent protein kinase complex, which regulates progression through the cell cycle. Activity of this protein is especially critical during the G1 to S phase transition. This protein associates with and regulated by other subunits of the complex including cyclin A or E, CDK inhibitor p21Cip1 (CDKN1A), and p27Kip1 (CDKN1B). Alternative splicing results in multiple transcript variants.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC0222]
• Molekulargewicht: 30 kDa/34 kDa
• NCBI: 1017
• UniProt: P24941
• Reinheit: Affinity purification
• Sequenz: RRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
• Target-Kategorie: CDK2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:6000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,Protein phosphorylation,Cancer,Signal Transduction,Kinase,Serine threonine kinases,ATM Signaling Pathway,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cell Cycle Control-G1 S Checkpoint

Bilder