[KO Validated] CDK2 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A0094
Artikelname: [KO Validated] CDK2 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A0094
Hersteller Artikelnummer: A0094
Alternativnummer: ABB-A0094-100UL,ABB-A0094-20UL,ABB-A0094-500UL,ABB-A0094-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CDKN2, p33(CDK2), K2
This gene encodes a member of a family of serine/threonine protein kinases that participate in cell cycle regulation. The encoded protein is the catalytic subunit of the cyclin-dependent protein kinase complex, which regulates progression through the cell cycle. Activity of this protein is especially critical during the G1 to S phase transition. This protein associates with and regulated by other subunits of the complex including cyclin A or E, CDK inhibitor p21Cip1 (CDKN1A), and p27Kip1 (CDKN1B). Alternative splicing results in multiple transcript variants.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0222]
Molekulargewicht: 30 kDa/34 kDa
NCBI: 1017
UniProt: P24941
Reinheit: Affinity purification
Sequenz: RRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
Target-Kategorie: CDK2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:6000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,Protein phosphorylation,Cancer,Signal Transduction,Kinase,Serine threonine kinases,ATM Signaling Pathway,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cell Cycle Control-G1 S Checkpoint.