[KO Validated] CDK2 Rabbit mAb, Unconjugated

Catalog Number: ABB-A0094
Article Name: [KO Validated] CDK2 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A0094
Supplier Catalog Number: A0094
Alternative Catalog Number: ABB-A0094-100UL,ABB-A0094-20UL,ABB-A0094-500UL,ABB-A0094-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CDKN2, p33(CDK2), K2
This gene encodes a member of a family of serine/threonine protein kinases that participate in cell cycle regulation. The encoded protein is the catalytic subunit of the cyclin-dependent protein kinase complex, which regulates progression through the cell cycle. Activity of this protein is especially critical during the G1 to S phase transition. This protein associates with and regulated by other subunits of the complex including cyclin A or E, CDK inhibitor p21Cip1 (CDKN1A), and p27Kip1 (CDKN1B). Alternative splicing results in multiple transcript variants.
Clonality: Monoclonal
Clone Designation: [ARC0222]
Molecular Weight: 30 kDa/34 kDa
NCBI: 1017
UniProt: P24941
Purity: Affinity purification
Sequence: RRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
Target: CDK2
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:6000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,Protein phosphorylation,Cancer,Signal Transduction,Kinase,Serine threonine kinases,ATM Signaling Pathway,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cell Cycle Control-G1 S Checkpoint