SERCA2/ATP2A2 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A0098
Artikelname: SERCA2/ATP2A2 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A0098
Hersteller Artikelnummer: A0098
Alternativnummer: ABB-A0098-20UL,ABB-A0098-100UL,ABB-A0098-1000UL,ABB-A0098-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: DD, DAR, ATP2B, SERCA2, SERCA2/ATP2A2
This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of the skeletal muscle. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol into the sarcoplasmic reticulum lumen, and is involved in regulation of the contraction/relaxation cycle. Mutations in this gene cause Darier-White disease, also known as keratosis follicularis, an autosomal dominant skin disorder characterized by loss of adhesion between epidermal cells and abnormal keratinization. Other types of mutations in this gene have been associated with various forms of muscular dystrophies. Alternative splicing results in multiple transcript variants encoding different isoforms.
Klonalität: Polyclonal
Molekulargewicht: 115kDa
NCBI: 488
UniProt: P16615
Reinheit: Affinity purification
Sequenz: NAENAIEALKEYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKL
Target-Kategorie: ATP2A2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Neuroscience,Calcium Signaling,Neurodegenerative Diseases,Cardiovascular,Heart,Contractility.