SERCA2/ATP2A2 Rabbit pAb, Unconjugated

Catalog Number: ABB-A0098
Article Name: SERCA2/ATP2A2 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0098
Supplier Catalog Number: A0098
Alternative Catalog Number: ABB-A0098-20UL,ABB-A0098-100UL,ABB-A0098-1000UL,ABB-A0098-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: DD, DAR, ATP2B, SERCA2, SERCA2/ATP2A2
This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of the skeletal muscle. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol into the sarcoplasmic reticulum lumen, and is involved in regulation of the contraction/relaxation cycle. Mutations in this gene cause Darier-White disease, also known as keratosis follicularis, an autosomal dominant skin disorder characterized by loss of adhesion between epidermal cells and abnormal keratinization. Other types of mutations in this gene have been associated with various forms of muscular dystrophies. Alternative splicing results in multiple transcript variants encoding different isoforms.
Clonality: Polyclonal
Molecular Weight: 115kDa
NCBI: 488
UniProt: P16615
Purity: Affinity purification
Sequence: NAENAIEALKEYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKL
Target: ATP2A2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Neuroscience,Calcium Signaling,Neurodegenerative Diseases,Cardiovascular,Heart,Contractility