FOXO3A Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: FOXO3A Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0102
• Hersteller Artikelnummer: A0102
• Alternativnummer: ABB-A0102-100UL,ABB-A0102-20UL,ABB-A0102-500UL,ABB-A0102-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: Fkhr2, FKHRL1, Foxo3a, 1110048B16Rik, 2010203A17Rik, FOXO3A

Produktbeschreibung

Enables DNA binding activity, DNA-binding transcription factor activity, RNA polymerase II-specific, and mitochondrial transcription factor activity. Involved in several processes, including mitochondrial transcription, positive regulation of muscle atrophy, and positive regulation of pri-miRNA transcription by RNA polymerase II. Acts upstream of or within several processes, including extrinsic apoptotic signaling pathway in absence of ligand, female gonad development, and neuronal stem cell population maintenance. Located in cytosol, mitochondrial outer membrane, and nucleus. Part of protein-containing complex. Colocalizes with mitochondrial matrix. Is expressed in several structures, including alimentary system, brain, early embryo, genitourinary system, and hemolymphoid system. Used to study dermoid cyst of ovary. Orthologous to human FOXO3 (forkhead box O3).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 71kDa
• NCBI: 56484
• UniProt: Q9WVH4
• Reinheit: Affinity purification
• Sequenz: LSDSSSLGSAKHQQQSPASQSMQTLSDSLSGSSLYSASANLPVMGHDKFPSDLDLDMFNGSLECDMESIIRSELMDAD
• Target-Kategorie: Foxo3
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics & Nuclear Signaling,Transcription Factors,Signal Transduction,G protein signaling,G2/M DNA Damage Checkpoint,MAPK-Erk Signaling Pathway,Cell Biology & Developmental Biology,Autophagy,Cell Cycle,G1/S Checkpoint,Endocrine & Metabolism,Insulin Receptor Signaling Pathway,Immunology & Inflammation,B Cell Receptor Signaling Pathway

Bilder