FOXO3A Rabbit pAb, Unconjugated

Catalog Number: ABB-A0102
Article Name: FOXO3A Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0102
Supplier Catalog Number: A0102
Alternative Catalog Number: ABB-A0102-100UL,ABB-A0102-20UL,ABB-A0102-500UL,ABB-A0102-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: Fkhr2, FKHRL1, Foxo3a, 1110048B16Rik, 2010203A17Rik, FOXO3A
Enables DNA binding activity, DNA-binding transcription factor activity, RNA polymerase II-specific, and mitochondrial transcription factor activity. Involved in several processes, including mitochondrial transcription, positive regulation of muscle atrophy, and positive regulation of pri-miRNA transcription by RNA polymerase II. Acts upstream of or within several processes, including extrinsic apoptotic signaling pathway in absence of ligand, female gonad development, and neuronal stem cell population maintenance. Located in cytosol, mitochondrial outer membrane, and nucleus. Part of protein-containing complex. Colocalizes with mitochondrial matrix. Is expressed in several structures, including alimentary system, brain, early embryo, genitourinary system, and hemolymphoid system. Used to study dermoid cyst of ovary. Orthologous to human FOXO3 (forkhead box O3).
Clonality: Polyclonal
Molecular Weight: 71kDa
NCBI: 56484
UniProt: Q9WVH4
Purity: Affinity purification
Sequence: LSDSSSLGSAKHQQQSPASQSMQTLSDSLSGSSLYSASANLPVMGHDKFPSDLDLDMFNGSLECDMESIIRSELMDAD
Target: Foxo3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics & Nuclear Signaling,Transcription Factors,Signal Transduction,G protein signaling,G2/M DNA Damage Checkpoint,MAPK-Erk Signaling Pathway,Cell Biology & Developmental Biology,Autophagy,Cell Cycle,G1/S Checkpoint,Endocrine & Metabolism,Insulin Receptor Signaling Pathway,Immunology & Inflammation,B Cell Receptor Signaling Pathway