CDK6 Rabbit mAb, Clone: [ARC0224], Unconjugated, Monoclonal

Produktübersicht

• Artikelname: CDK6 Rabbit mAb, Clone: [ARC0224], Unconjugated, Monoclonal
• Artikelnummer: ABB-A0106
• Hersteller Artikelnummer: A0106
• Alternativnummer: ABB-A0106-500UL,ABB-A0106-200UL,ABB-A0106-50UL,ABB-A0106-100UL,ABB-A0106-20UL,ABB-A0106-1000UL,ABB-A0106-5UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 227-326 of human CDK6 (Q00534).
• Konjugation: Unconjugated
• Alternative Synonym: MCPH12, PLSTIRE, CDK6

Produktbeschreibung

The protein encoded by this gene is a member of the CMGC family of serine/threonine protein kinases. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC0224]
• Molekulargewicht: 37kDa
• NCBI: 1021
• UniProt: Q00534
• Quelle: Rabbit
• Reinheit: Affinity purification
• Sequenz: QLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA
• Target-Kategorie: CDK6
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000
• Anwendungsbeschreibung: Cross-reactivity: Human,Rat, Research area: Epigenetics Nuclear Signaling,Protein phosphorylation,Cancer,Signal Transduction,Kinase,Serine threonine kinases,Cell Biology Developmental Biology,Cell Cycle,Cell Cycle Control-G1 S Checkpoint