CDK6 Rabbit mAb, Clone: [ARC0224], Unconjugated, Monoclonal

Product Overview

• Article Name: CDK6 Rabbit mAb, Clone: [ARC0224], Unconjugated, Monoclonal
• Biozol Catalog Number: ABB-A0106
• Supplier Catalog Number: A0106
• Alternative Catalog Number: ABB-A0106-500UL,ABB-A0106-200UL,ABB-A0106-50UL,ABB-A0106-100UL,ABB-A0106-20UL,ABB-A0106-1000UL,ABB-A0106-5UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 227-326 of human CDK6 (Q00534).
• Conjugation: Unconjugated
• Alternative Names: MCPH12, PLSTIRE, CDK6

Product Description

The protein encoded by this gene is a member of the CMGC family of serine/threonine protein kinases. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity

Product Properties

• Clonality: Monoclonal
• Clone Designation: [ARC0224]
• Molecular Weight: 37kDa
• NCBI: 1021
• UniProt: Q00534
• Source: Rabbit
• Purity: Affinity purification
• Sequence: QLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA
• Target: CDK6
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000
• Application Notes: Cross-reactivity: Human,Rat, Research area: Epigenetics Nuclear Signaling,Protein phosphorylation,Cancer,Signal Transduction,Kinase,Serine threonine kinases,Cell Biology Developmental Biology,Cell Cycle,Cell Cycle Control-G1 S Checkpoint