MSP/MST1 Rabbit mAb, Clone: [ARC1809], Unconjugated, Monoclonal

Produktübersicht

• Artikelname: MSP/MST1 Rabbit mAb, Clone: [ARC1809], Unconjugated, Monoclonal
• Artikelnummer: ABB-A0109
• Hersteller Artikelnummer: A0109
• Alternativnummer: ABB-A0109-100UL,ABB-A0109-20UL,ABB-A0109-1000UL,ABB-A0109-50UL,ABB-A0109-200UL,ABB-A0109-500UL,ABB-A0109-5UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MSP/MST1 (P26927).
• Konjugation: Unconjugated
• Alternative Synonym: MSP, HGFL, NF15S2, D3F15S2, DNF15S2, MSP/MST1

Produktbeschreibung

The protein encoded by this gene contains four kringle domains and a serine protease domain, similar to that found in hepatic growth factor. Despite the presence of the serine protease domain, the encoded protein may not have any proteolytic activity. Th

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC1809]
• Molekulargewicht: 80kDa
• NCBI: 4485
• UniProt: P26927
• Quelle: Rabbit
• Reinheit: Affinity purification
• Sequenz: MGWLPLLLLLTQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRCGPLMDCRAFHYNVSSHGCQLLPWTQHSPHTRLRRSGRCDL
• Target-Kategorie: MST1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200
• Anwendungsbeschreibung: Cross-reactivity: Human,Mouse,Rat, Research area: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Cancer,Tumor biomarkers,Signal Transduction,Kinase,Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway