MSP/MST1 Rabbit mAb, Clone: [ARC1809], Unconjugated, Monoclonal

Catalog Number: ABB-A0109
Article Name: MSP/MST1 Rabbit mAb, Clone: [ARC1809], Unconjugated, Monoclonal
Biozol Catalog Number: ABB-A0109
Supplier Catalog Number: A0109
Alternative Catalog Number: ABB-A0109-100UL,ABB-A0109-20UL,ABB-A0109-1000UL,ABB-A0109-50UL,ABB-A0109-200UL,ABB-A0109-500UL,ABB-A0109-5UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MSP/MST1 (P26927).
Conjugation: Unconjugated
Alternative Names: MSP, HGFL, NF15S2, D3F15S2, DNF15S2, MSP/MST1
The protein encoded by this gene contains four kringle domains and a serine protease domain, similar to that found in hepatic growth factor. Despite the presence of the serine protease domain, the encoded protein may not have any proteolytic activity. Th
Clonality: Monoclonal
Clone Designation: [ARC1809]
Molecular Weight: 80kDa
NCBI: 4485
UniProt: P26927
Source: Rabbit
Purity: Affinity purification
Sequence: MGWLPLLLLLTQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRCGPLMDCRAFHYNVSSHGCQLLPWTQHSPHTRLRRSGRCDL
Target: MST1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200
Application Notes: Cross-reactivity: Human,Mouse,Rat, Research area: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Cancer,Tumor biomarkers,Signal Transduction,Kinase,Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway