CCR7 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A0121
Artikelname: CCR7 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A0121
Hersteller Artikelnummer: A0121
Alternativnummer: ABB-A0121-100UL,ABB-A0121-20UL,ABB-A0121-500UL,ABB-A0121-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: BLR2, EBI1, CCR-7, CD197, CDw197, CMKBR7, CC-CKR-7, CCR7
The protein encoded by this gene is a member of the G protein-coupled receptor family.This receptor was identified as a gene induced by the Epstein-Barr virus (EBV),and is thought to be a mediator of EBV effects on B lymphocytes.This receptor is expressed in various lymphoid tissues and activates B and T lymphocytes.It has been shown to control the migration of memory T cells to inflamed tissues,as well as stimulate dendritic cell maturation.The chemokine (C-C motif) ligand 19 (CCL19/ECL) has been reported to be a specific ligand of this receptor.Signals mediated by this receptor regulate T cell homeostasis in lymph nodes,and may also function in the activation and polarization of T cells,and in chronic inflammation pathogenesis.Alternative splicing of this gene results in multiple transcript variants.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0231]
Molekulargewicht: 43kDa
NCBI: 1236
UniProt: P32248
Reinheit: Affinity purification
Sequenz: MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNL
Target-Kategorie: CCR7
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:6000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Immunology Inflammation,CDs,Cell Intrinsic Innate Immunity Signaling Pathway