CCR7 Rabbit mAb, Clone: [ARC0231], Unconjugated, Monoclonal
Artikelnummer:
ABB-A0121
- Bilder (0)
Artikelname: | CCR7 Rabbit mAb, Clone: [ARC0231], Unconjugated, Monoclonal |
Artikelnummer: | ABB-A0121 |
Hersteller Artikelnummer: | A0121 |
Alternativnummer: | ABB-A0121-100UL,ABB-A0121-500UL,ABB-A0121-20UL,ABB-A0121-200UL,ABB-A0121-1000UL,ABB-A0121-50UL,ABB-A0121-5UL |
Hersteller: | ABclonal |
Wirt: | Rabbit |
Kategorie: | Antikörper |
Applikation: | ELISA, IF, IHC-P, WB |
Spezies Reaktivität: | Human, Mouse, Rat |
Immunogen: | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CCR7 (P32248). |
Konjugation: | Unconjugated |
Alternative Synonym: | BLR2, EBI1, CCR-7, CD197, CDw197, CMKBR7, CC-CKR-7, CCR7 |
The protein encoded by this gene is a member of the G protein-coupled receptor family.This receptor was identified as a gene induced by the Epstein-Barr virus (EBV),and is thought to be a mediator of EBV effects on B lymphocytes.This receptor is expresse |
Klonalität: | Monoclonal |
Klon-Bezeichnung: | [ARC0231] |
Molekulargewicht: | 43kDa |
NCBI: | 1236 |
UniProt: | P32248 |
Quelle: | Rabbit |
Reinheit: | Affinity purification |
Sequenz: | MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNL |
Target-Kategorie: | CCR7 |
Antibody Type: | Primary Antibody |
Application Verdünnung: | WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200 |
Anwendungsbeschreibung: | Cross-reactivity: Human,Mouse,Rat, Research area: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Immunology Inflammation,CDs,Cell Intrinsic Innate Immunity Signaling Pathway |