CCR7 Rabbit mAb, Clone: [ARC0231], Unconjugated, Monoclonal

Product Overview

• Article Name: CCR7 Rabbit mAb, Clone: [ARC0231], Unconjugated, Monoclonal
• Biozol Catalog Number: ABB-A0121
• Supplier Catalog Number: A0121
• Alternative Catalog Number: ABB-A0121-100UL,ABB-A0121-500UL,ABB-A0121-20UL,ABB-A0121-200UL,ABB-A0121-1000UL,ABB-A0121-50UL,ABB-A0121-5UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CCR7 (P32248).
• Conjugation: Unconjugated
• Alternative Names: BLR2, EBI1, CCR-7, CD197, CDw197, CMKBR7, CC-CKR-7, CCR7

Product Description

The protein encoded by this gene is a member of the G protein-coupled receptor family.This receptor was identified as a gene induced by the Epstein-Barr virus (EBV),and is thought to be a mediator of EBV effects on B lymphocytes.This receptor is expresse

Product Properties

• Clonality: Monoclonal
• Clone Designation: [ARC0231]
• Molecular Weight: 43kDa
• NCBI: 1236
• UniProt: P32248
• Source: Rabbit
• Purity: Affinity purification
• Sequence: MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNL
• Target: CCR7
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200
• Application Notes: Cross-reactivity: Human,Mouse,Rat, Research area: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Immunology Inflammation,CDs,Cell Intrinsic Innate Immunity Signaling Pathway