CCR7 Rabbit mAb, Unconjugated

Catalog Number: ABB-A0121
Article Name: CCR7 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A0121
Supplier Catalog Number: A0121
Alternative Catalog Number: ABB-A0121-100UL,ABB-A0121-20UL,ABB-A0121-500UL,ABB-A0121-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: BLR2, EBI1, CCR-7, CD197, CDw197, CMKBR7, CC-CKR-7, CCR7
The protein encoded by this gene is a member of the G protein-coupled receptor family.This receptor was identified as a gene induced by the Epstein-Barr virus (EBV),and is thought to be a mediator of EBV effects on B lymphocytes.This receptor is expressed in various lymphoid tissues and activates B and T lymphocytes.It has been shown to control the migration of memory T cells to inflamed tissues,as well as stimulate dendritic cell maturation.The chemokine (C-C motif) ligand 19 (CCL19/ECL) has been reported to be a specific ligand of this receptor.Signals mediated by this receptor regulate T cell homeostasis in lymph nodes,and may also function in the activation and polarization of T cells,and in chronic inflammation pathogenesis.Alternative splicing of this gene results in multiple transcript variants.
Clonality: Monoclonal
Clone Designation: [ARC0231]
Molecular Weight: 43kDa
NCBI: 1236
UniProt: P32248
Purity: Affinity purification
Sequence: MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNL
Target: CCR7
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:6000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Immunology Inflammation,CDs,Cell Intrinsic Innate Immunity Signaling Pathway.