SHIP1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: SHIP1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A0122
• Hersteller Artikelnummer: A0122
• Alternativnummer: ABB-A0122-200UL,ABB-A0122-50UL,ABB-A0122-1000UL,ABB-A0122-100UL,ABB-A0122-500UL,ABB-A0122-20UL,ABB-A0122-5UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human SHIP1 (NP_001017915.1).
• Konjugation: Unconjugated
• Alternative Synonym: SHIP, SHIP1, SHIP-1, hp51CN, SIP-145, p150Ship

Produktbeschreibung

This gene is a member of the inositol polyphosphate-5-phosphatase (INPP5) family and encodes a protein with an N-terminal SH2 domain, an inositol phosphatase domain, and two C-terminal protein interaction domains. Expression of this protein is restricted

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 133kDa
• NCBI: 3635
• UniProt: Q92835
• Quelle: Rabbit
• Reinheit: Affinity purification
• Sequenz: PPCSGSSITEIINPNYMGVGPFGPPMPLHVKQTLSPDQQPTAWSYDQPPKDSPLGPCRGESPPTPPGQPPISPKKFLPSTANRGLPPRTQESRPSDLGKNA
• Target-Kategorie: INPP5D
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200
• Anwendungsbeschreibung: Cross-reactivity: Human,Mouse,Rat, Research area: Epigenetics Nuclear Signaling,Protein phosphorylation,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Endocrine Metabolism,Lipid Metabolism,Insulin Receptor Signaling Pathway,Immunology I