SHIP1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: SHIP1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A0122
• Supplier Catalog Number: A0122
• Alternative Catalog Number: ABB-A0122-200UL,ABB-A0122-50UL,ABB-A0122-1000UL,ABB-A0122-100UL,ABB-A0122-500UL,ABB-A0122-20UL,ABB-A0122-5UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human SHIP1 (NP_001017915.1).
• Conjugation: Unconjugated
• Alternative Names: SHIP, SHIP1, SHIP-1, hp51CN, SIP-145, p150Ship

Product Description

This gene is a member of the inositol polyphosphate-5-phosphatase (INPP5) family and encodes a protein with an N-terminal SH2 domain, an inositol phosphatase domain, and two C-terminal protein interaction domains. Expression of this protein is restricted

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 133kDa
• NCBI: 3635
• UniProt: Q92835
• Source: Rabbit
• Purity: Affinity purification
• Sequence: PPCSGSSITEIINPNYMGVGPFGPPMPLHVKQTLSPDQQPTAWSYDQPPKDSPLGPCRGESPPTPPGQPPISPKKFLPSTANRGLPPRTQESRPSDLGKNA
• Target: INPP5D
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200
• Application Notes: Cross-reactivity: Human,Mouse,Rat, Research area: Epigenetics Nuclear Signaling,Protein phosphorylation,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Endocrine Metabolism,Lipid Metabolism,Insulin Receptor Signaling Pathway,Immunology I