NCSTN Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: NCSTN Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A0128
• Hersteller Artikelnummer: A0128
• Alternativnummer: ABB-A0128-200UL,ABB-A0128-20UL,ABB-A0128-500UL,ABB-A0128-50UL,ABB-A0128-1000UL,ABB-A0128-100UL,ABB-A0128-5UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 250-578 of human NCSTN (NP_056146.1).
• Konjugation: Unconjugated
• Alternative Synonym: ATAG1874, NCSTN

Produktbeschreibung

This gene encodes a type I transmembrane glycoprotein that is an integral component of the multimeric gamma-secretase complex. The encoded protein cleaves integral membrane proteins, including Notch receptors and beta-amyloid precursor protein, and may b

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 78kDa
• NCBI: 23385
• UniProt: Q92542
• Quelle: Rabbit
• Reinheit: Affinity purification
• Sequenz: PLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALQKAPDVTTLPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQVEDLLATLEKSGAGVPAVILRRPNQSQPLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFVTDTAKALADVATVLGRALYELAG
• Target-Kategorie: NCSTN
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200
• Anwendungsbeschreibung: Cross-reactivity: Human,Mouse,Rat, Research area: Signal Transduction,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,ESC Pluripotency and Differentiation,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle For