NCSTN Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: NCSTN Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A0128
• Supplier Catalog Number: A0128
• Alternative Catalog Number: ABB-A0128-200UL,ABB-A0128-20UL,ABB-A0128-500UL,ABB-A0128-50UL,ABB-A0128-1000UL,ABB-A0128-100UL,ABB-A0128-5UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 250-578 of human NCSTN (NP_056146.1).
• Conjugation: Unconjugated
• Alternative Names: ATAG1874, NCSTN

Product Description

This gene encodes a type I transmembrane glycoprotein that is an integral component of the multimeric gamma-secretase complex. The encoded protein cleaves integral membrane proteins, including Notch receptors and beta-amyloid precursor protein, and may b

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 78kDa
• NCBI: 23385
• UniProt: Q92542
• Source: Rabbit
• Purity: Affinity purification
• Sequence: PLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALQKAPDVTTLPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQVEDLLATLEKSGAGVPAVILRRPNQSQPLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFVTDTAKALADVATVLGRALYELAG
• Target: NCSTN
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200
• Application Notes: Cross-reactivity: Human,Mouse,Rat, Research area: Signal Transduction,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,ESC Pluripotency and Differentiation,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle For