LRP5 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: LRP5 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A0130
• Hersteller Artikelnummer: A0130
• Alternativnummer: ABB-A0130-100UL,ABB-A0130-500UL,ABB-A0130-1000UL,ABB-A0130-200UL,ABB-A0130-20UL,ABB-A0130-50UL,ABB-A0130-5UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1400-1500 of human LRP5 (NP_002326.2).
• Konjugation: Unconjugated
• Alternative Synonym: HBM, LR3, OPS, EVR1, EVR4, LRP7, OPPG, BMND1, LRP-5, LRP-7, OPTA1, PCLD4, VBCH2, LRP5

Produktbeschreibung

This gene encodes a transmembrane low-density lipoprotein receptor that binds and internalizes ligands in the process of receptor-mediated endocytosis. This protein also acts as a co-receptor with Frizzled protein family members for transducing signals b

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 179kDa
• NCBI: 4041
• UniProt: O75197
• Quelle: Rabbit
• Reinheit: Affinity purification
• Sequenz: MGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNP
• Target-Kategorie: LRP5
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200
• Anwendungsbeschreibung: Cross-reactivity: Mouse,Rat, Research area: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Cancer,Signal Transduction,mTOR Signaling Pathway,Cell Biology Developmental Biology,Cytoskeleton,Microtubules,Extracellula