LRP5 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: LRP5 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A0130
• Supplier Catalog Number: A0130
• Alternative Catalog Number: ABB-A0130-100UL,ABB-A0130-500UL,ABB-A0130-1000UL,ABB-A0130-200UL,ABB-A0130-20UL,ABB-A0130-50UL,ABB-A0130-5UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1400-1500 of human LRP5 (NP_002326.2).
• Conjugation: Unconjugated
• Alternative Names: HBM, LR3, OPS, EVR1, EVR4, LRP7, OPPG, BMND1, LRP-5, LRP-7, OPTA1, PCLD4, VBCH2, LRP5

Product Description

This gene encodes a transmembrane low-density lipoprotein receptor that binds and internalizes ligands in the process of receptor-mediated endocytosis. This protein also acts as a co-receptor with Frizzled protein family members for transducing signals b

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 179kDa
• NCBI: 4041
• UniProt: O75197
• Source: Rabbit
• Purity: Affinity purification
• Sequence: MGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNP
• Target: LRP5
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200
• Application Notes: Cross-reactivity: Mouse,Rat, Research area: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Cancer,Signal Transduction,mTOR Signaling Pathway,Cell Biology Developmental Biology,Cytoskeleton,Microtubules,Extracellula