PSD95 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: PSD95 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0131
• Hersteller Artikelnummer: A0131
• Alternativnummer: ABB-A0131-100UL,ABB-A0131-20UL,ABB-A0131-500UL,ABB-A0131-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MRD62, PSD95, SAP90, SAP-90

Produktbeschreibung

This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC0236]
• Molekulargewicht: 80kDa
• NCBI: 1742
• UniProt: P78352
• Reinheit: Affinity purification
• Sequenz: MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKII
• Target-Kategorie: DLG4
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Neuroscience, Cell Type Marker,Neurodegenerative Diseases,Neuron marker,Synapse marker