PSD95 Rabbit mAb, Clone: [ARC0236], Unconjugated, Monoclonal

Produktübersicht

• Artikelname: PSD95 Rabbit mAb, Clone: [ARC0236], Unconjugated, Monoclonal
• Artikelnummer: ABB-A0131
• Hersteller Artikelnummer: A0131
• Alternativnummer: ABB-A0131-50UL,ABB-A0131-500UL,ABB-A0131-200UL,ABB-A0131-100UL,ABB-A0131-1000UL,ABB-A0131-20UL,ABB-A0131-5UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PSD95 (P78352).
• Konjugation: Unconjugated
• Alternative Synonym: MRD62, PSD95, SAP90, SAP-90

Produktbeschreibung

This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at po

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC0236]
• Molekulargewicht: 80kDa
• NCBI: 1742
• UniProt: P78352
• Quelle: Rabbit
• Reinheit: Affinity purification
• Sequenz: MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKII
• Target-Kategorie: DLG4
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000
• Anwendungsbeschreibung: Cross-reactivity: Mouse,Rat, Research area: Signal Transduction,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Neuroscience, Cell Type Marker,Neurodegenerative Diseases,Neuron marker,Synapse marker