PSD95 Rabbit mAb, Clone: [ARC0236], Unconjugated, Monoclonal

Product Overview

• Article Name: PSD95 Rabbit mAb, Clone: [ARC0236], Unconjugated, Monoclonal
• Biozol Catalog Number: ABB-A0131
• Supplier Catalog Number: A0131
• Alternative Catalog Number: ABB-A0131-50UL,ABB-A0131-500UL,ABB-A0131-200UL,ABB-A0131-100UL,ABB-A0131-1000UL,ABB-A0131-20UL,ABB-A0131-5UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PSD95 (P78352).
• Conjugation: Unconjugated
• Alternative Names: MRD62, PSD95, SAP90, SAP-90

Product Description

This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at po

Product Properties

• Clonality: Monoclonal
• Clone Designation: [ARC0236]
• Molecular Weight: 80kDa
• NCBI: 1742
• UniProt: P78352
• Source: Rabbit
• Purity: Affinity purification
• Sequence: MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKII
• Target: DLG4
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000
• Application Notes: Cross-reactivity: Mouse,Rat, Research area: Signal Transduction,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Neuroscience, Cell Type Marker,Neurodegenerative Diseases,Neuron marker,Synapse marker