PSD95 Rabbit mAb, Unconjugated

Catalog Number: ABB-A0131
Article Name: PSD95 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A0131
Supplier Catalog Number: A0131
Alternative Catalog Number: ABB-A0131-100UL,ABB-A0131-20UL,ABB-A0131-500UL,ABB-A0131-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MRD62, PSD95, SAP90, SAP-90
This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene.
Clonality: Monoclonal
Clone Designation: [ARC0236]
Molecular Weight: 80kDa
NCBI: 1742
UniProt: P78352
Purity: Affinity purification
Sequence: MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKII
Target: DLG4
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat, ResearchArea: Signal Transduction,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Neuroscience, Cell Type Marker,Neurodegenerative Diseases,Neuron marker,Synapse marker.