ALDH1A1 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: ALDH1A1 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0157
• Hersteller Artikelnummer: A0157
• Alternativnummer: ABB-A0157-20UL,ABB-A0157-100UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IP, WB
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human ALDH1A1 (NP_000680.2).
• Konjugation: Unconjugated
• Alternative Synonym: ALDC, ALDH1, HEL-9, HEL12, PUMB1, ALDH11, RALDH1, ALDH-E1, HEL-S-53e, ALDH1A1

Produktbeschreibung

The protein encoded by this gene belongs to the aldehyde dehydrogenase family. Aldehyde dehydrogenase is the next enzyme after alcohol dehydrogenase in the major pathway of alcohol metabolism. There are two major aldehyde dehydrogenase isozymes in the liver, cytosolic and mitochondrial, which are encoded by distinct genes, and can be distinguished by their electrophoretic mobility, kinetic properties, and subcellular localization. This gene encodes the cytosolic isozyme. Studies in mice show that through its role in retinol metabolism, this gene may also be involved in the regulation of the metabolic responses to high-fat diet.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC52440]
• Molekulargewicht: 55kDa
• NCBI: 216
• UniProt: P00352
• Reinheit: Affinity purification
• Sequenz: VGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQ
• Target-Kategorie: ALDH1A1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:10000 - 1:60000|IF/ICC,1:8000 - 1:32000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor biomarkers,Neuroscience, Cell Type Marker,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease,Stem Cells,Hematopoietic Progenitors,Neuron marker

Bilder