ALDH1A1 Rabbit mAb, Unconjugated

Catalog Number: ABB-A0157
Article Name: ALDH1A1 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A0157
Supplier Catalog Number: A0157
Alternative Catalog Number: ABB-A0157-20UL,ABB-A0157-100UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IP, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human ALDH1A1 (NP_000680.2).
Conjugation: Unconjugated
Alternative Names: ALDC, ALDH1, HEL-9, HEL12, PUMB1, ALDH11, RALDH1, ALDH-E1, HEL-S-53e, ALDH1A1
The protein encoded by this gene belongs to the aldehyde dehydrogenase family. Aldehyde dehydrogenase is the next enzyme after alcohol dehydrogenase in the major pathway of alcohol metabolism. There are two major aldehyde dehydrogenase isozymes in the liver, cytosolic and mitochondrial, which are encoded by distinct genes, and can be distinguished by their electrophoretic mobility, kinetic properties, and subcellular localization. This gene encodes the cytosolic isozyme. Studies in mice show that through its role in retinol metabolism, this gene may also be involved in the regulation of the metabolic responses to high-fat diet.
Clonality: Monoclonal
Clone Designation: [ARC52440]
Molecular Weight: 55kDa
NCBI: 216
UniProt: P00352
Purity: Affinity purification
Sequence: VGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQ
Target: ALDH1A1
Antibody Type: Primary Antibody
Application Dilute: WB,1:10000 - 1:60000|IF/ICC,1:8000 - 1:32000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor biomarkers,Neuroscience, Cell Type Marker,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease,Stem Cells,Hematopoietic Progenitors,Neuron marker