GDF15 Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A0185
- Bilder (2)
| Artikelname: | GDF15 Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A0185 |
| Hersteller Artikelnummer: | A0185 |
| Alternativnummer: | ABB-A0185-20UL,ABB-A0185-100UL,ABB-A0185-1000UL,ABB-A0185-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, IP, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PDF, MIC1, PLAB, MIC-1, NAG-1, PTGFB, GDF-15, GDF15 |
| This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. The protein is expressed in a broad range of cell types, acts as a pleiotropic cytokine and is involved in the stress response program of cells after cellular injury. Increased protein levels are associated with disease states such as tissue hypoxia, inflammation, acute injury and oxidative stress. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 34kDa |
| NCBI: | 9518 |
| UniProt: | Q99988 |
| Reinheit: | Affinity purification |
| Sequenz: | EDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAK |
| Target-Kategorie: | GDF15 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Cytoskeleton,Extracellular Matrix,Bone,Growth factors,Immunology Inflammation,Cytokines,Cardiovascular,Heart,Hypertrophy |
|
|
|
|
|
Produktgarantie und fachkundiger Support
