GDF15 Rabbit pAb, Unconjugated

Product Overview

• Article Name: GDF15 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A0185
• Supplier Catalog Number: A0185
• Alternative Catalog Number: ABB-A0185-20UL,ABB-A0185-100UL,ABB-A0185-1000UL,ABB-A0185-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, IP, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PDF, MIC1, PLAB, MIC-1, NAG-1, PTGFB, GDF-15, GDF15

Product Description

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. The protein is expressed in a broad range of cell types, acts as a pleiotropic cytokine and is involved in the stress response program of cells after cellular injury. Increased protein levels are associated with disease states such as tissue hypoxia, inflammation, acute injury and oxidative stress.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 34kDa
• NCBI: 9518
• UniProt: Q99988
• Purity: Affinity purification
• Sequence: EDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAK
• Target: GDF15
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Cytoskeleton,Extracellular Matrix,Bone,Growth factors,Immunology Inflammation,Cytokines,Cardiovascular,Heart,Hypertrophy.

Images

Immunohistochemistry analysis of paraffin-embedded Human placenta using GDF15 Rabbit pAb (A0185) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunofluorescence analysis of BALB-3T3 cells using GDF15 Rabbit pAb (A0185) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western blot analysis of various lysates using GDF15 Rabbit pAb (A0185) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Immunoprecipitation analysis of 200 µg extracts of HT-1080 cells using 3 µg GDF15 antibody (A0185). Western blot was performed from the immunoprecipitate using GDF15 antibody (A0185) at a dilution of 1:1000.