Bcl10 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A0191
Artikelname: Bcl10 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A0191
Hersteller Artikelnummer: A0191
Alternativnummer: ABB-A0191-20UL,ABB-A0191-100UL,ABB-A0191-500UL,ABB-A0191-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CLAP, mE10, CIPER, IMD37, c-E10, CARMEN, Bcl10
This gene was identified by its translocation in a case of mucosa-associated lymphoid tissue (MALT) lymphoma. The protein encoded by this gene contains a caspase recruitment domain (CARD), and has been shown to induce apoptosis and to activate NF-kappaB. This protein is reported to interact with other CARD domain containing proteins including CARD9, 10, 11 and 14, which are thought to function as upstream regulators in NF-kappaB signaling. This protein is found to form a complex with MALT1, a protein encoded by another gene known to be translocated in MALT lymphoma. MALT1 and this protein are thought to synergize in the activation of NF-kappaB, and the deregulation of either of them may contribute to the same pathogenetic process that leads to the malignancy. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 26kDa
NCBI: 8915
UniProt: O95999
Reinheit: Affinity purification
Sequenz: MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLK
Target-Kategorie: BCL10
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Caspases,Endocrine Metabolism,Immunology Inflammation,B Cell Receptor Signaling Pathway,T Cell Receptor Signaling Pathway.
Western blot analysis of various lysates using Bcl10 Rabbit pAb (A0191) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Western blot analysis of lysates from Rat spleen, using Bcl10 Rabbit pAb (A0191) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of lysates from mouse ovary, using Bcl10 Rabbit pAb (A0191).
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.