Bcl10 Rabbit pAb, Unconjugated

Catalog Number: ABB-A0191
Article Name: Bcl10 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0191
Supplier Catalog Number: A0191
Alternative Catalog Number: ABB-A0191-20UL,ABB-A0191-100UL,ABB-A0191-500UL,ABB-A0191-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CLAP, mE10, CIPER, IMD37, c-E10, CARMEN, Bcl10
This gene was identified by its translocation in a case of mucosa-associated lymphoid tissue (MALT) lymphoma. The protein encoded by this gene contains a caspase recruitment domain (CARD), and has been shown to induce apoptosis and to activate NF-kappaB. This protein is reported to interact with other CARD domain containing proteins including CARD9, 10, 11 and 14, which are thought to function as upstream regulators in NF-kappaB signaling. This protein is found to form a complex with MALT1, a protein encoded by another gene known to be translocated in MALT lymphoma. MALT1 and this protein are thought to synergize in the activation of NF-kappaB, and the deregulation of either of them may contribute to the same pathogenetic process that leads to the malignancy. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 26kDa
NCBI: 8915
UniProt: O95999
Purity: Affinity purification
Sequence: MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLK
Target: BCL10
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Caspases,Endocrine Metabolism,Immunology Inflammation,B Cell Receptor Signaling Pathway,T Cell Receptor Signaling Pathway