Alpha-Fetoprotein (AFP) Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A0200
- Bilder (2)
| Artikelname: | Alpha-Fetoprotein (AFP) Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A0200 |
| Hersteller Artikelnummer: | A0200 |
| Alternativnummer: | ABB-A0200-100UL,ABB-A0200-20UL,ABB-A0200-1000UL,ABB-A0200-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AFPD, FETA, HPAFP, Alpha-Fetoprotein (AFP) |
| This gene encodes alpha-fetoprotein, a major plasma protein produced by the yolk sac and the liver during fetal life. Alpha-fetoprotein expression in adults is often associated with hepatocarcinoma and with teratoma, and has prognostic value for managing advanced gastric cancer. However, hereditary persistance of alpha-fetoprotein may also be found in individuals with no obvious pathology. The protein is thought to be the fetal counterpart of serum albumin, and the alpha-fetoprotein and albumin genes are present in tandem in the same transcriptional orientation on chromosome 4. Alpha-fetoprotein is found in monomeric as well as dimeric and trimeric forms, and binds copper, nickel, fatty acids and bilirubin. The level of alpha-fetoprotein in amniotic fluid is used to measure renal loss of protein to screen for spina bifida and anencephaly. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 69kDa |
| NCBI: | 174 |
| UniProt: | P02771 |
| Reinheit: | Affinity purification |
| Sequenz: | RRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV |
| Target-Kategorie: | AFP |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor biomarkers,Cell Biology Developmental Biology,Stem Cells,Cardiovascular,Blood,Serum Proteins |
|
|
|
|
|
Produktgarantie und fachkundiger Support
