Alpha-Fetoprotein (AFP) Rabbit pAb, Unconjugated

Catalog Number: ABB-A0200
Article Name: Alpha-Fetoprotein (AFP) Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0200
Supplier Catalog Number: A0200
Alternative Catalog Number: ABB-A0200-100UL,ABB-A0200-20UL,ABB-A0200-1000UL,ABB-A0200-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: AFPD, FETA, HPAFP, Alpha-Fetoprotein (AFP)
This gene encodes alpha-fetoprotein, a major plasma protein produced by the yolk sac and the liver during fetal life. Alpha-fetoprotein expression in adults is often associated with hepatocarcinoma and with teratoma, and has prognostic value for managing advanced gastric cancer. However, hereditary persistance of alpha-fetoprotein may also be found in individuals with no obvious pathology. The protein is thought to be the fetal counterpart of serum albumin, and the alpha-fetoprotein and albumin genes are present in tandem in the same transcriptional orientation on chromosome 4. Alpha-fetoprotein is found in monomeric as well as dimeric and trimeric forms, and binds copper, nickel, fatty acids and bilirubin. The level of alpha-fetoprotein in amniotic fluid is used to measure renal loss of protein to screen for spina bifida and anencephaly.
Clonality: Polyclonal
Molecular Weight: 69kDa
NCBI: 174
UniProt: P02771
Purity: Affinity purification
Sequence: RRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV
Target: AFP
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor biomarkers,Cell Biology Developmental Biology,Stem Cells,Cardiovascular,Blood,Serum Proteins