Bak Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: Bak Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0204
• Hersteller Artikelnummer: A0204
• Alternativnummer: ABB-A0204-100UL,ABB-A0204-20UL,ABB-A0204-1000UL,ABB-A0204-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: BAK, CDN1, BCL2L7, BAK-LIKE, Bak

Produktbeschreibung

The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 23kDa
• NCBI: 578
• UniProt: Q16611
• Reinheit: Affinity purification
• Sequenz: EGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGF
• Target-Kategorie: BAK1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Endocrine Metabolism,Mitochondrial metabolism

Bilder