Bak Rabbit pAb, Unconjugated

Catalog Number: ABB-A0204
Article Name: Bak Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0204
Supplier Catalog Number: A0204
Alternative Catalog Number: ABB-A0204-100UL,ABB-A0204-20UL,ABB-A0204-1000UL,ABB-A0204-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IP, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: BAK, CDN1, BCL2L7, BAK-LIKE, Bak
The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress.
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 578
UniProt: Q16611
Purity: Affinity purification
Sequence: EGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGF
Target: BAK1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Endocrine Metabolism,Mitochondrial metabolism