Bcl-2 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: Bcl-2 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0208
• Hersteller Artikelnummer: A0208
• Alternativnummer: ABB-A0208-100UL,ABB-A0208-20UL,ABB-A0208-500UL,ABB-A0208-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: Bcl-2, PPP1R50

Produktbeschreibung

This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Alternative splicing results in multiple transcript variants.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 26kDa
• NCBI: 596
• UniProt: P10415
• Reinheit: Affinity purification
• Sequenz: MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQA
• Target-Kategorie: BCL2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Protein phosphorylation,Cancer,Tumor biomarkers,Invasion and Metastasis,Signal Transduction,PI3K-Akt Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Inhibition of Apoptosis,Autophagy,Death Receptor Signaling Pathway,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Immunology Inflammation,Neuroscience,Neurodegenerative Diseases,Stem Cells

Bilder