Bcl-2 Rabbit pAb, Unconjugated

Product Overview

• Article Name: Bcl-2 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A0208
• Supplier Catalog Number: A0208
• Alternative Catalog Number: ABB-A0208-100UL,ABB-A0208-20UL,ABB-A0208-500UL,ABB-A0208-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, IP, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: Bcl-2, PPP1R50

Product Description

This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Alternative splicing results in multiple transcript variants.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 26kDa
• NCBI: 596
• UniProt: P10415
• Purity: Affinity purification
• Sequence: MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQA
• Target: BCL2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Protein phosphorylation,Cancer,Tumor biomarkers,Invasion and Metastasis,Signal Transduction,PI3K-Akt Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Inhibition of Apoptosis,Autophagy,Death Receptor Signaling Pathway,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Immunology Inflammation,Neuroscience,Neurodegenerative Diseases,Stem Cells

Images