c-Fos Rabbit pAb, Unconjugated

Artikelnummer: ABB-A0236
Artikelname: c-Fos Rabbit pAb, Unconjugated
Artikelnummer: ABB-A0236
Hersteller Artikelnummer: A0236
Alternativnummer: ABB-A0236-20UL,ABB-A0236-100UL,ABB-A0236-1000UL,ABB-A0236-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: p55, AP-1, C-FOS, c-Fos
The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death.
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 2353
UniProt: P01100
Reinheit: Affinity purification
Sequenz: MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKT
Target-Kategorie: FOS
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Protein phosphorylation,Cancer,Tumor biomarkers,Signal Transduction,ErbB-HER Signaling Pathway,MAPK-Erk Signaling Pathway,Immunology Inflammation,T Cell Receptor Signaling Pathway,Neuroscience, Cell Type Marker,Neuron marker.