c-Fos Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: c-Fos Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0236
• Hersteller Artikelnummer: A0236
• Alternativnummer: ABB-A0236-20UL,ABB-A0236-100UL,ABB-A0236-1000UL,ABB-A0236-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: p55, AP-1, C-FOS, c-Fos

Produktbeschreibung

The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 41kDa
• NCBI: 2353
• UniProt: P01100
• Reinheit: Affinity purification
• Sequenz: MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKT
• Target-Kategorie: FOS
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Protein phosphorylation,Cancer,Tumor biomarkers,Signal Transduction,ErbB-HER Signaling Pathway,MAPK-Erk Signaling Pathway,Immunology Inflammation,T Cell Receptor Signaling Pathway,Neuroscience, Cell Type Marker,Neuron marker

Bilder