c-Fos Rabbit pAb, Unconjugated

Catalog Number: ABB-A0236
Article Name: c-Fos Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0236
Supplier Catalog Number: A0236
Alternative Catalog Number: ABB-A0236-20UL,ABB-A0236-100UL,ABB-A0236-1000UL,ABB-A0236-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IP, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: p55, AP-1, C-FOS, c-Fos
The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death.
Clonality: Polyclonal
Molecular Weight: 41kDa
NCBI: 2353
UniProt: P01100
Purity: Affinity purification
Sequence: MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKT
Target: FOS
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Protein phosphorylation,Cancer,Tumor biomarkers,Signal Transduction,ErbB-HER Signaling Pathway,MAPK-Erk Signaling Pathway,Immunology Inflammation,T Cell Receptor Signaling Pathway,Neuroscience, Cell Type Marker,Neuron marker.