HSP27/HSPB1 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A0240
Artikelname: HSP27/HSPB1 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A0240
Hersteller Artikelnummer: A0240
Alternativnummer: ABB-A0240-500UL,ABB-A0240-100UL,ABB-A0240-20UL,ABB-A0240-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CMT2F, HMN2B, HSP27, HSP28, Hsp25, SRP27, HS.76067, HEL-S-102, HSP27/HSPB1
This gene encodes a member of the small heat shock protein (HSP20) family of proteins. In response to environmental stress, the encoded protein translocates from the cytoplasm to the nucleus and functions as a molecular chaperone that promotes the correct folding of other proteins. This protein plays an important role in the differentiation of a wide variety of cell types. Expression of this gene is correlated with poor clinical outcome in multiple human cancers, and the encoded protein may promote cancer cell proliferation and metastasis, while protecting cancer cells from apoptosis. Mutations in this gene have been identified in human patients with Charcot-Marie-Tooth disease and distal hereditary motor neuropathy.
Molekulargewicht: 23kDa
NCBI: 3315
UniProt: P04792
Reinheit: Affinity purification
Sequenz: MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLD
Target-Kategorie: HSPB1
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Protein phosphorylation,Cancer,Tumor biomarkers,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Inhibition of Apoptosis,Cytoskeleton,Actins,Stem Cells,Cardiovascular,Heart,Contractility