HSP27/HSPB1 Rabbit pAb, Unconjugated

Catalog Number: ABB-A0240
Article Name: HSP27/HSPB1 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0240
Supplier Catalog Number: A0240
Alternative Catalog Number: ABB-A0240-500UL,ABB-A0240-100UL,ABB-A0240-20UL,ABB-A0240-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CMT2F, HMN2B, HSP27, HSP28, Hsp25, SRP27, HS.76067, HEL-S-102, HSP27/HSPB1
This gene encodes a member of the small heat shock protein (HSP20) family of proteins. In response to environmental stress, the encoded protein translocates from the cytoplasm to the nucleus and functions as a molecular chaperone that promotes the correct folding of other proteins. This protein plays an important role in the differentiation of a wide variety of cell types. Expression of this gene is correlated with poor clinical outcome in multiple human cancers, and the encoded protein may promote cancer cell proliferation and metastasis, while protecting cancer cells from apoptosis. Mutations in this gene have been identified in human patients with Charcot-Marie-Tooth disease and distal hereditary motor neuropathy.
Molecular Weight: 23kDa
NCBI: 3315
UniProt: P04792
Purity: Affinity purification
Sequence: MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLD
Target: HSPB1
Application Dilute: WB,1:500 - 1:2000|IHC-P,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Protein phosphorylation,Cancer,Tumor biomarkers,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Inhibition of Apoptosis,Cytoskeleton,Actins,Stem Cells,Cardiovascular,Heart,Contractility