[KD Validated] IGF1R Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: [KD Validated] IGF1R Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0243
• Hersteller Artikelnummer: A0243
• Alternativnummer: ABB-A0243-20UL,ABB-A0243-100UL,ABB-A0243-500UL,ABB-A0243-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: IGFR, CD221, IGFIR, JTK13, 1R

Produktbeschreibung

This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 155kDa
• NCBI: 3480
• UniProt: P08069
• Reinheit: Affinity purification
• Sequenz: VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
• Target-Kategorie: IGF1R
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Protein phosphorylation,Cancer,Signal Transduction,Kinase,Tyrosine kinases,Cell Biology Developmental Biology,Apoptosis,Growth factors,ESC Pluripotency and Differentiation,Immunology Inflammation,CDs,Cardiovascular,Angiogenesis

Bilder