[KD Validated] IGF1R Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A0243
- Bilder (2)
| Artikelname: | [KD Validated] IGF1R Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A0243 |
| Hersteller Artikelnummer: | A0243 |
| Alternativnummer: | ABB-A0243-20UL,ABB-A0243-100UL,ABB-A0243-500UL,ABB-A0243-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | IGFR, CD221, IGFIR, JTK13, 1R |
| This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 155kDa |
| NCBI: | 3480 |
| UniProt: | P08069 |
| Reinheit: | Affinity purification |
| Sequenz: | VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC |
| Target-Kategorie: | IGF1R |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Protein phosphorylation,Cancer,Signal Transduction,Kinase,Tyrosine kinases,Cell Biology Developmental Biology,Apoptosis,Growth factors,ESC Pluripotency and Differentiation,Immunology Inflammation,CDs,Cardiovascular,Angiogenesis. |


