[KD Validated] IGF1R Rabbit pAb, Unconjugated

Catalog Number: ABB-A0243
Article Name: [KD Validated] IGF1R Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0243
Supplier Catalog Number: A0243
Alternative Catalog Number: ABB-A0243-20UL,ABB-A0243-100UL,ABB-A0243-500UL,ABB-A0243-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: IGFR, CD221, IGFIR, JTK13, 1R
This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 155kDa
NCBI: 3480
UniProt: P08069
Purity: Affinity purification
Sequence: VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
Target: IGF1R
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Protein phosphorylation,Cancer,Signal Transduction,Kinase,Tyrosine kinases,Cell Biology Developmental Biology,Apoptosis,Growth factors,ESC Pluripotency and Differentiation,Immunology Inflammation,CDs,Cardiovascular,Angiogenesis.