IRS1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: IRS1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0245
• Hersteller Artikelnummer: A0245
• Alternativnummer: ABB-A0245-20UL,ABB-A0245-100UL,ABB-A0245-500UL,ABB-A0245-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HIRS-1, IRS1

Produktbeschreibung

This gene encodes a protein which is phosphorylated by insulin receptor tyrosine kinase. Mutations in this gene are associated with type II diabetes and susceptibility to insulin resistance.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 132kDa
• NCBI: 3667
• UniProt: P35568
• Reinheit: Affinity purification
• Sequenz: SPTGPQGAAELAAHSSLLGGPQGPGGMSAFTRVNLSPNRNQSAKVIRADPQGCRRRHSSETFSSTPSATRVGNTVPFGAGAAVGGGGGSSSSSEDVKRHSSASFENVWLRPGELGGAPKEPAKLCGAAGGLENGLNYIDLDLVKDFKQCPQECTPEPQPPPPPPPHQPLGSGESSSTRRSSEDLSAYASISFQKQPEDRQ
• Target-Kategorie: IRS1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Protein phosphorylation,Cancer,Signal Transduction,PI3K-Akt Signaling Pathway,mTOR Signaling Pathway,MAPK-Erk Signaling Pathway,MAPK-JNK Signaling Pathway,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,Insulin Receptor Signaling Pathway,Endocrine and metabolic diseases,Diabetes,Obesity,Immunology Inflammation,Neuroscience, Cell Type Marker,Cardiovascular,Heart,Cardiovascular diseases,Heart disease

Bilder