IRS1 Rabbit pAb, Unconjugated

Catalog Number: ABB-A0245
Article Name: IRS1 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0245
Supplier Catalog Number: A0245
Alternative Catalog Number: ABB-A0245-20UL,ABB-A0245-100UL,ABB-A0245-500UL,ABB-A0245-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HIRS-1, IRS1
This gene encodes a protein which is phosphorylated by insulin receptor tyrosine kinase. Mutations in this gene are associated with type II diabetes and susceptibility to insulin resistance.
Clonality: Polyclonal
Molecular Weight: 132kDa
NCBI: 3667
UniProt: P35568
Purity: Affinity purification
Sequence: SPTGPQGAAELAAHSSLLGGPQGPGGMSAFTRVNLSPNRNQSAKVIRADPQGCRRRHSSETFSSTPSATRVGNTVPFGAGAAVGGGGGSSSSSEDVKRHSSASFENVWLRPGELGGAPKEPAKLCGAAGGLENGLNYIDLDLVKDFKQCPQECTPEPQPPPPPPPHQPLGSGESSSTRRSSEDLSAYASISFQKQPEDRQ
Target: IRS1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Protein phosphorylation,Cancer,Signal Transduction,PI3K-Akt Signaling Pathway,mTOR Signaling Pathway,MAPK-Erk Signaling Pathway,MAPK-JNK Signaling Pathway,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,Insulin Receptor Signaling Pathway,Endocrine and metabolic diseases,Diabetes,Obesity,Immunology Inflammation,Neuroscience, Cell Type Marker,Cardiovascular,Heart,Cardiovascular diseases,Heart disease