MDK Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: MDK Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0251
• Hersteller Artikelnummer: A0251
• Alternativnummer: ABB-A0251-100UL,ABB-A0251-20UL,ABB-A0251-1000UL,ABB-A0251-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MK, ARAP, NEGF2, MDK

Produktbeschreibung

This gene encodes a member of a small family of secreted growth factors that binds heparin and responds to retinoic acid. The encoded protein promotes cell growth, migration, and angiogenesis, in particular during tumorigenesis. This gene has been targeted as a therapeutic for a variety of different disorders. Alternatively spliced transcript variants encoding multiple isoforms have been observed.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 16kDa
• NCBI: 4192
• UniProt: P21741
• Reinheit: Affinity purification
• Sequenz: KKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
• Target-Kategorie: MDK
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Growth factors,Immunology Inflammation,Cytokines,Neuroscience

Bilder