MDK Rabbit pAb, Unconjugated

Catalog Number: ABB-A0251
Article Name: MDK Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0251
Supplier Catalog Number: A0251
Alternative Catalog Number: ABB-A0251-100UL,ABB-A0251-20UL,ABB-A0251-1000UL,ABB-A0251-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MK, ARAP, NEGF2, MDK
This gene encodes a member of a small family of secreted growth factors that binds heparin and responds to retinoic acid. The encoded protein promotes cell growth, migration, and angiogenesis, in particular during tumorigenesis. This gene has been targeted as a therapeutic for a variety of different disorders. Alternatively spliced transcript variants encoding multiple isoforms have been observed.
Clonality: Polyclonal
Molecular Weight: 16kDa
NCBI: 4192
UniProt: P21741
Purity: Affinity purification
Sequence: KKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
Target: MDK
Antibody Type: Primary Antibody
Application Dilute: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cell Biology Developmental Biology,Growth factors,Immunology Inflammation,Cytokines,Neuroscience.