PBEF/Visfatin/NAMPT Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A0256
- Bilder (2)
| Artikelname: | PBEF/Visfatin/NAMPT Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A0256 |
| Hersteller Artikelnummer: | A0256 |
| Alternativnummer: | ABB-A0256-100UL,ABB-A0256-20UL,ABB-A0256-1000UL,ABB-A0256-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | VF, PBEF, PBEF1, VISFATIN, 1110035O14Rik, PBEF/Visfatin/NAMPT |
| This gene encodes a protein that catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein belongs to the nicotinic acid phosphoribosyltransferase (NAPRTase) family and is thought to be involved in many important biological processes, including metabolism, stress response and aging. This gene has a pseudogene on chromosome 10. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 56kDa |
| NCBI: | 10135 |
| UniProt: | P43490 |
| Reinheit: | Affinity purification |
| Sequenz: | GNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINTLQEIVEGMKQKMWSIENIAFGS |
| Target-Kategorie: | NAMPT |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,Immunology Inflammation,Cytokines,Cell Intrinsic Innate Immunity Signaling Pathway,Neuroscience,Cardiovascular,Blood,Serum Proteins,Hypoxia |
|
|
|
|
|
Produktgarantie und fachkundiger Support
