PBEF/Visfatin/NAMPT Rabbit pAb, Unconjugated

Catalog Number: ABB-A0256
Article Name: PBEF/Visfatin/NAMPT Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0256
Supplier Catalog Number: A0256
Alternative Catalog Number: ABB-A0256-100UL,ABB-A0256-20UL,ABB-A0256-1000UL,ABB-A0256-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: VF, PBEF, PBEF1, VISFATIN, 1110035O14Rik, PBEF/Visfatin/NAMPT
This gene encodes a protein that catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein belongs to the nicotinic acid phosphoribosyltransferase (NAPRTase) family and is thought to be involved in many important biological processes, including metabolism, stress response and aging. This gene has a pseudogene on chromosome 10.
Clonality: Polyclonal
Molecular Weight: 56kDa
NCBI: 10135
UniProt: P43490
Purity: Affinity purification
Sequence: GNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINTLQEIVEGMKQKMWSIENIAFGS
Target: NAMPT
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,Immunology Inflammation,Cytokines,Cell Intrinsic Innate Immunity Signaling Pathway,Neuroscience,Cardiovascular,Blood,Serum Proteins,Hypoxia